← All skills

design-doc-mermaid

77 / 100 · Review before installing

Check before installing. Some of what it can do is expected: a coding skill usually runs build and test commands.

By lev-os/agents (GitHub) · coding · 28 stars · scanned at commit b247a6d

Create Mermaid diagrams (activity, deployment, sequence, architecture) from text descriptions or source code. Use when asked to "create a diagram", "generate mermaid", "document architecture", "code to diagram", "create design doc", or "convert code to diagram". Supports hierarchical on-demand guide loading, Unicode semantic symbols, and Python utilities for diagram extraction and image conversion.

Works with any agent that supports SKILL.md skills.

What this skill can do

Safer alternatives

Low-risk skills in the same category (coding) that look related. Check that one does what you need.

• 97 Low riskpretty-mermaidivanrvpereira/.agents · 19 stars
• 82 Low riskmermaid-studiodiegosouzapw/awesome-omni-skill · 66 stars
• 80 Low riskopenakita/skills@pretty-mermaidopenakita/openakita · 2,017 stars

Install

Paste this into your terminal. It downloads exactly the version we scanned, not whatever is newest.

if [ -e ~/.agents/skills/'design-doc-mermaid' ] || [ -L ~/.agents/skills/'design-doc-mermaid' ]; then echo 'A skill folder named design-doc-mermaid already exists — not replacing it' >&2; false; else d=$(mktemp -d) && git clone --quiet --filter=blob:none --no-checkout 'https://github.com/lev-os/agents' "$d" && git -C "$d" checkout --quiet 'b247a6df3094b3f2c2780c0f34a9f05925627ffc' -- 'skills-db/creative/design-doc-mermaid' && mkdir -p ~/.agents/skills && cp -R "$d"/'skills-db/creative/design-doc-mermaid' ~/.agents/skills/'design-doc-mermaid' && rm -rf "$d"; fi

Codex reads ~/.agents/skills directly. For Claude Code, Cursor, Copilot, Gemini CLI, Antigravity or OpenCode, also link it. For Claude Code: ln -s ~/.agents/skills/'design-doc-mermaid' ~/.claude/skills/'design-doc-mermaid' (other agents: ~/.cursor/skills, ~/.copilot/skills, ~/.gemini/skills, ~/.gemini/config/skills, ~/.config/opencode/skills). Or install through the finder skill, which does both.

Badge for your README

The badge for lev-os/agents shows the score of its lowest-scoring skill.

[![SkillTrust](https://zalavijaysinh.github.io/skilltrust/badges/lev-os/agents.svg)](https://zalavijaysinh.github.io/skilltrust/repos/lev-os/agents/)

Score history